Anti SLC10A7 pAb (ATL-HPA057906)

Atlas Antibodies

Catalog No: ATL-HPA057906-25

• 

Product Description

Protein Description: solute carrier family 10, member 7
Gene Name: SLC10A7
Alternative Gene Name: C4orf13, DKFZp313H0531, DKFZp566M114, DKFZp779O2438, MGC25043
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091318: 33%, ENSRNOG00000031855: 33%
Entrez Gene ID: 84068
Uniprot ID: Q0GE19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSWMVSRQKKLLQTRGPLANLNNPEGLEYLSIKFGH
• Gene Sequence: KSWMVSRQKKLLQTRGPLANLNNPEGLEYLSIKFGH
• Gene ID - Mouse: ENSMUSG00000091318
• Gene ID - Rat: ENSRNOG00000031855
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.