Protein Description: solute carrier family 10 (sodium/bile acid cotransporter), member 2
Gene Name: SLC10A2
Alternative Gene Name: ASBT, ISBT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023073: 47%, ENSRNOG00000003302: 42%
Entrez Gene ID: 6555
Uniprot ID: Q12908
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC10A2
Alternative Gene Name: ASBT, ISBT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023073: 47%, ENSRNOG00000003302: 42%
Entrez Gene ID: 6555
Uniprot ID: Q12908
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NKAEIPESKENGTEPESSFYKANGGFQPDE |
| Documents & Links for Anti SLC10A2 pAb (ATL-HPA004795 w/enhanced validation) | |
| Datasheet | Anti SLC10A2 pAb (ATL-HPA004795 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLC10A2 pAb (ATL-HPA004795 w/enhanced validation) at Atlas |
| Documents & Links for Anti SLC10A2 pAb (ATL-HPA004795 w/enhanced validation) | |
| Datasheet | Anti SLC10A2 pAb (ATL-HPA004795 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLC10A2 pAb (ATL-HPA004795 w/enhanced validation) |
| Citations for Anti SLC10A2 pAb (ATL-HPA004795 w/enhanced validation) – 2 Found |
| Xiao, Yongtao; Yan, Weihui; Lu, Ying; Zhou, Kejun; Cai, Wei. Neurotensin contributes to pediatric intestinal failure-associated liver disease via regulating intestinal bile acids uptake. Ebiomedicine. 2018;35( 30104181):133-141. PubMed |
| Yu, Qianhui; Kilik, Umut; Holloway, Emily M; Tsai, Yu-Hwai; Harmel, Christoph; Wu, Angeline; Wu, Joshua H; Czerwinski, Michael; Childs, Charlie J; He, Zhisong; Capeling, Meghan M; Huang, Sha; Glass, Ian A; Higgins, Peter D R; Treutlein, Barbara; Spence, Jason R; Camp, J Gray. Charting human development using a multi-endodermal organ atlas and organoid models. Cell. 2021;184(12):3281-3298.e22. PubMed |