Anti SLBP pAb (ATL-HPA061670 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA061670-25

• 
• 

Product Description

Protein Description: stem-loop binding protein
Gene Name: SLBP
Alternative Gene Name: HBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004642: 88%, ENSRNOG00000037162: 88%
Entrez Gene ID: 7884
Uniprot ID: Q14493
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESSSEPQTSSQDDFDVYSGTPTKVRHMDSQVEDEFDLEACLTEPLRDFSAM
• Gene Sequence: ESSSEPQTSSQDDFDVYSGTPTKVRHMDSQVEDEFDLEACLTEPLRDFSAM
• Gene ID - Mouse: ENSMUSG00000004642
• Gene ID - Rat: ENSRNOG00000037162
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.