Description
Product Description
Protein Description: SLAM family member 8
Gene Name: SLAMF8
Alternative Gene Name: BLAME, CD353, SBBI42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053318: 75%, ENSRNOG00000008736: 75%
Entrez Gene ID: 56833
Uniprot ID: Q9P0V8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLAMF8
Alternative Gene Name: BLAME, CD353, SBBI42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053318: 75%, ENSRNOG00000008736: 75%
Entrez Gene ID: 56833
Uniprot ID: Q9P0V8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SEITYSWRRETTMDFGMEPHSLFTDGQVLSISLGPGDRDVAYSCIVSNPVSWDLATVTPWDSCHHEAAPGKASYKD |
Gene Sequence | SEITYSWRRETTMDFGMEPHSLFTDGQVLSISLGPGDRDVAYSCIVSNPVSWDLATVTPWDSCHHEAAPGKASYKD |
Gene ID - Mouse | ENSMUSG00000053318 |
Gene ID - Rat | ENSRNOG00000008736 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SLAMF8 pAb (ATL-HPA067601 w/enhanced validation) | |
Datasheet | Anti SLAMF8 pAb (ATL-HPA067601 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SLAMF8 pAb (ATL-HPA067601 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SLAMF8 pAb (ATL-HPA067601 w/enhanced validation) | |
Datasheet | Anti SLAMF8 pAb (ATL-HPA067601 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SLAMF8 pAb (ATL-HPA067601 w/enhanced validation) |