Protein Description: SLAM family member 8
Gene Name: SLAMF8
Alternative Gene Name: BLAME, CD353, SBBI42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053318: 75%, ENSRNOG00000008736: 75%
Entrez Gene ID: 56833
Uniprot ID: Q9P0V8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLAMF8
Alternative Gene Name: BLAME, CD353, SBBI42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053318: 75%, ENSRNOG00000008736: 75%
Entrez Gene ID: 56833
Uniprot ID: Q9P0V8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SEITYSWRRETTMDFGMEPHSLFTDGQVLSISLGPGDRDVAYSCIVSNPVSWDLATVTPWDSCHHEAAPGKASYKD |
| Documents & Links for Anti SLAMF8 pAb (ATL-HPA067601 w/enhanced validation) | |
| Datasheet | Anti SLAMF8 pAb (ATL-HPA067601 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLAMF8 pAb (ATL-HPA067601 w/enhanced validation) at Atlas |
| Documents & Links for Anti SLAMF8 pAb (ATL-HPA067601 w/enhanced validation) | |
| Datasheet | Anti SLAMF8 pAb (ATL-HPA067601 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLAMF8 pAb (ATL-HPA067601 w/enhanced validation) |