Anti SLAMF1 pAb (ATL-HPA069319 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA069319-25

• 

Product Description

Protein Description: signaling lymphocytic activation molecule family member 1
Gene Name: SLAMF1
Alternative Gene Name: CD150, SLAM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015316: 48%, ENSRNOG00000059073: 49%
Entrez Gene ID: 6504
Uniprot ID: Q13291
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKE
• Gene Sequence: KVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKE
• Gene ID - Mouse: ENSMUSG00000015316
• Gene ID - Rat: ENSRNOG00000059073
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.