Anti SLAIN2 pAb (ATL-HPA063599)

Atlas Antibodies

Catalog No: ATL-HPA063599-25

• 
• 

Product Description

Protein Description: SLAIN motif family, member 2
Gene Name: SLAIN2
Alternative Gene Name: FLJ21611, KIAA1458
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036087: 97%, ENSRNOG00000002271: 99%
Entrez Gene ID: 57606
Uniprot ID: Q9P270
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPARGIEYSRVSPQPMISRLQQPRLSLQGHPTDLQTSNVKNEEKLRRSLPNLSRTSNTQVDSVKSSRSDSNFQVPN
• Gene Sequence: SPARGIEYSRVSPQPMISRLQQPRLSLQGHPTDLQTSNVKNEEKLRRSLPNLSRTSNTQVDSVKSSRSDSNFQVPN
• Gene ID - Mouse: ENSMUSG00000036087
• Gene ID - Rat: ENSRNOG00000002271
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.