Protein Description: SLAIN motif family, member 2
Gene Name: SLAIN2
Alternative Gene Name: FLJ21611, KIAA1458
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036087: 97%, ENSRNOG00000002271: 99%
Entrez Gene ID: 57606
Uniprot ID: Q9P270
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLAIN2
Alternative Gene Name: FLJ21611, KIAA1458
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036087: 97%, ENSRNOG00000002271: 99%
Entrez Gene ID: 57606
Uniprot ID: Q9P270
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SPARGIEYSRVSPQPMISRLQQPRLSLQGHPTDLQTSNVKNEEKLRRSLPNLSRTSNTQVDSVKSSRSDSNFQVPN |
Documents & Links for Anti SLAIN2 pAb (ATL-HPA063599) | |
Datasheet | Anti SLAIN2 pAb (ATL-HPA063599) Datasheet (External Link) |
Vendor Page | Anti SLAIN2 pAb (ATL-HPA063599) at Atlas |
Documents & Links for Anti SLAIN2 pAb (ATL-HPA063599) | |
Datasheet | Anti SLAIN2 pAb (ATL-HPA063599) Datasheet (External Link) |
Vendor Page | Anti SLAIN2 pAb (ATL-HPA063599) |