Protein Description: Src-like-adaptor
Gene Name: SLA
Alternative Gene Name: SLA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022372: 73%, ENSRNOG00000056714: 71%
Entrez Gene ID: 6503
Uniprot ID: Q13239
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLA
Alternative Gene Name: SLA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022372: 73%, ENSRNOG00000056714: 71%
Entrez Gene ID: 6503
Uniprot ID: Q13239
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PCLTQSTAAPAVRASSSPVTLRQKTVDWRRVSRLQEDPEGTENPLGVDESLFSYGLRESIASYLSLTSEDNTSFDRKKKSISLMYGGSKRKSSFFSSPP |
| Documents & Links for Anti SLA pAb (ATL-HPA074192) | |
| Datasheet | Anti SLA pAb (ATL-HPA074192) Datasheet (External Link) |
| Vendor Page | Anti SLA pAb (ATL-HPA074192) at Atlas |
| Documents & Links for Anti SLA pAb (ATL-HPA074192) | |
| Datasheet | Anti SLA pAb (ATL-HPA074192) Datasheet (External Link) |
| Vendor Page | Anti SLA pAb (ATL-HPA074192) |