Anti SIX3 pAb (ATL-HPA067988)

Atlas Antibodies

Catalog No: ATL-HPA067988-25

• 

Product Description

Protein Description: SIX homeobox 3
Gene Name: SIX3
Alternative Gene Name: HPE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038805: 100%, ENSRNOG00000057031: 100%
Entrez Gene ID: 6496
Uniprot ID: O95343
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KNRLQHQAIGPSGMRSLAEPGCPTHGSAESPSTAASPTTSVSSLTERADTGTSILSVTSSDS
• Gene Sequence: KNRLQHQAIGPSGMRSLAEPGCPTHGSAESPSTAASPTTSVSSLTERADTGTSILSVTSSDS
• Gene ID - Mouse: ENSMUSG00000038805
• Gene ID - Rat: ENSRNOG00000057031
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.