Protein Description: SIVA1, apoptosis-inducing factor
Gene Name: SIVA1
Alternative Gene Name: CD27BP, SIVA, Siva-1, Siva-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064326: 68%, ENSRNOG00000028640: 74%
Entrez Gene ID: 10572
Uniprot ID: O15304
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SIVA1
Alternative Gene Name: CD27BP, SIVA, Siva-1, Siva-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064326: 68%, ENSRNOG00000028640: 74%
Entrez Gene ID: 10572
Uniprot ID: O15304
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | IRSLGQASEADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACT |
Documents & Links for Anti SIVA1 pAb (ATL-HPA066693) | |
Datasheet | Anti SIVA1 pAb (ATL-HPA066693) Datasheet (External Link) |
Vendor Page | Anti SIVA1 pAb (ATL-HPA066693) at Atlas |
Documents & Links for Anti SIVA1 pAb (ATL-HPA066693) | |
Datasheet | Anti SIVA1 pAb (ATL-HPA066693) Datasheet (External Link) |
Vendor Page | Anti SIVA1 pAb (ATL-HPA066693) |