Anti SIPA1L3 pAb (ATL-HPA074988)

Catalog No:
ATL-HPA074988-25
$447.00

Description

Product Description

Protein Description: signal induced proliferation associated 1 like 3
Gene Name: SIPA1L3
Alternative Gene Name: KIAA0545
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030583: 89%, ENSRNOG00000020703: 89%
Entrez Gene ID: 23094
Uniprot ID: O60292
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QPSGSFSTPGSATYVRYKPSPERYTAAPHPLLSLDPHFSHDGTSSGDSSSGGLTSQESTMERQKPEPLWHVPAQARLSAIAGSSGNKHPSR
Gene Sequence QPSGSFSTPGSATYVRYKPSPERYTAAPHPLLSLDPHFSHDGTSSGDSSSGGLTSQESTMERQKPEPLWHVPAQARLSAIAGSSGNKHPSR
Gene ID - Mouse ENSMUSG00000030583
Gene ID - Rat ENSRNOG00000020703
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SIPA1L3 pAb (ATL-HPA074988)
Datasheet Anti SIPA1L3 pAb (ATL-HPA074988) Datasheet (External Link)
Vendor Page Anti SIPA1L3 pAb (ATL-HPA074988) at Atlas Antibodies

Documents & Links for Anti SIPA1L3 pAb (ATL-HPA074988)
Datasheet Anti SIPA1L3 pAb (ATL-HPA074988) Datasheet (External Link)
Vendor Page Anti SIPA1L3 pAb (ATL-HPA074988)

Product Description

Protein Description: signal induced proliferation associated 1 like 3
Gene Name: SIPA1L3
Alternative Gene Name: KIAA0545
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030583: 89%, ENSRNOG00000020703: 89%
Entrez Gene ID: 23094
Uniprot ID: O60292
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QPSGSFSTPGSATYVRYKPSPERYTAAPHPLLSLDPHFSHDGTSSGDSSSGGLTSQESTMERQKPEPLWHVPAQARLSAIAGSSGNKHPSR
Gene Sequence QPSGSFSTPGSATYVRYKPSPERYTAAPHPLLSLDPHFSHDGTSSGDSSSGGLTSQESTMERQKPEPLWHVPAQARLSAIAGSSGNKHPSR
Gene ID - Mouse ENSMUSG00000030583
Gene ID - Rat ENSRNOG00000020703
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SIPA1L3 pAb (ATL-HPA074988)
Datasheet Anti SIPA1L3 pAb (ATL-HPA074988) Datasheet (External Link)
Vendor Page Anti SIPA1L3 pAb (ATL-HPA074988) at Atlas Antibodies

Documents & Links for Anti SIPA1L3 pAb (ATL-HPA074988)
Datasheet Anti SIPA1L3 pAb (ATL-HPA074988) Datasheet (External Link)
Vendor Page Anti SIPA1L3 pAb (ATL-HPA074988)