Protein Description: signal induced proliferation associated 1 like 3
Gene Name: SIPA1L3
Alternative Gene Name: KIAA0545
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030583: 89%, ENSRNOG00000020703: 89%
Entrez Gene ID: 23094
Uniprot ID: O60292
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SIPA1L3
Alternative Gene Name: KIAA0545
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030583: 89%, ENSRNOG00000020703: 89%
Entrez Gene ID: 23094
Uniprot ID: O60292
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | QPSGSFSTPGSATYVRYKPSPERYTAAPHPLLSLDPHFSHDGTSSGDSSSGGLTSQESTMERQKPEPLWHVPAQARLSAIAGSSGNKHPSR |
Documents & Links for Anti SIPA1L3 pAb (ATL-HPA074988) | |
Datasheet | Anti SIPA1L3 pAb (ATL-HPA074988) Datasheet (External Link) |
Vendor Page | Anti SIPA1L3 pAb (ATL-HPA074988) at Atlas |
Documents & Links for Anti SIPA1L3 pAb (ATL-HPA074988) | |
Datasheet | Anti SIPA1L3 pAb (ATL-HPA074988) Datasheet (External Link) |
Vendor Page | Anti SIPA1L3 pAb (ATL-HPA074988) |