Description
Product Description
Protein Description: SIN3 transcription regulator family member A
Gene Name: SIN3A
Alternative Gene Name: DKFZP434K2235, KIAA0700
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042557: 96%, ENSRNOG00000032254: 95%
Entrez Gene ID: 25942
Uniprot ID: Q96ST3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SIN3A
Alternative Gene Name: DKFZP434K2235, KIAA0700
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042557: 96%, ENSRNOG00000032254: 95%
Entrez Gene ID: 25942
Uniprot ID: Q96ST3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVV |
Gene Sequence | LDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVV |
Gene ID - Mouse | ENSMUSG00000042557 |
Gene ID - Rat | ENSRNOG00000032254 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SIN3A pAb (ATL-HPA062123 w/enhanced validation) | |
Datasheet | Anti SIN3A pAb (ATL-HPA062123 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SIN3A pAb (ATL-HPA062123 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SIN3A pAb (ATL-HPA062123 w/enhanced validation) | |
Datasheet | Anti SIN3A pAb (ATL-HPA062123 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SIN3A pAb (ATL-HPA062123 w/enhanced validation) |