Description
Product Description
Protein Description: salt inducible kinase 2
Gene Name: SIK2
Alternative Gene Name: DKFZp434K1115, KIAA0781, LOH11CR1I, QIK, SNF1LK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037112: 89%, ENSRNOG00000043498: 89%
Entrez Gene ID: 23235
Uniprot ID: Q9H0K1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SIK2
Alternative Gene Name: DKFZp434K1115, KIAA0781, LOH11CR1I, QIK, SNF1LK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037112: 89%, ENSRNOG00000043498: 89%
Entrez Gene ID: 23235
Uniprot ID: Q9H0K1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VHPQLSPRQSLETQYLQHRLQKPSLLSKAQNTCQLYCKEPPRSLEQQLQEHRLQQKRLFLQKQSQLQAYFNQMQI |
Gene Sequence | VHPQLSPRQSLETQYLQHRLQKPSLLSKAQNTCQLYCKEPPRSLEQQLQEHRLQQKRLFLQKQSQLQAYFNQMQI |
Gene ID - Mouse | ENSMUSG00000037112 |
Gene ID - Rat | ENSRNOG00000043498 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SIK2 pAb (ATL-HPA071049) | |
Datasheet | Anti SIK2 pAb (ATL-HPA071049) Datasheet (External Link) |
Vendor Page | Anti SIK2 pAb (ATL-HPA071049) at Atlas Antibodies |
Documents & Links for Anti SIK2 pAb (ATL-HPA071049) | |
Datasheet | Anti SIK2 pAb (ATL-HPA071049) Datasheet (External Link) |
Vendor Page | Anti SIK2 pAb (ATL-HPA071049) |