Anti SHROOM2 pAb (ATL-HPA061435)

Catalog No:
ATL-HPA061435-25
$447.00

Description

Product Description

Protein Description: shroom family member 2
Gene Name: SHROOM2
Alternative Gene Name: APXL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045180: 44%, ENSRNOG00000024322: 42%
Entrez Gene ID: 357
Uniprot ID: Q13796
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPRHHLPQPEGPPDARETGRCYPLDKGAEGCSAGAQEPPRASRAEKASQRLAASITWADGESSRICPQETPLLHSLTQ
Gene Sequence SPRHHLPQPEGPPDARETGRCYPLDKGAEGCSAGAQEPPRASRAEKASQRLAASITWADGESSRICPQETPLLHSLTQ
Gene ID - Mouse ENSMUSG00000045180
Gene ID - Rat ENSRNOG00000024322
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SHROOM2 pAb (ATL-HPA061435)
Datasheet Anti SHROOM2 pAb (ATL-HPA061435) Datasheet (External Link)
Vendor Page Anti SHROOM2 pAb (ATL-HPA061435) at Atlas Antibodies

Documents & Links for Anti SHROOM2 pAb (ATL-HPA061435)
Datasheet Anti SHROOM2 pAb (ATL-HPA061435) Datasheet (External Link)
Vendor Page Anti SHROOM2 pAb (ATL-HPA061435)

Product Description

Protein Description: shroom family member 2
Gene Name: SHROOM2
Alternative Gene Name: APXL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045180: 44%, ENSRNOG00000024322: 42%
Entrez Gene ID: 357
Uniprot ID: Q13796
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPRHHLPQPEGPPDARETGRCYPLDKGAEGCSAGAQEPPRASRAEKASQRLAASITWADGESSRICPQETPLLHSLTQ
Gene Sequence SPRHHLPQPEGPPDARETGRCYPLDKGAEGCSAGAQEPPRASRAEKASQRLAASITWADGESSRICPQETPLLHSLTQ
Gene ID - Mouse ENSMUSG00000045180
Gene ID - Rat ENSRNOG00000024322
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SHROOM2 pAb (ATL-HPA061435)
Datasheet Anti SHROOM2 pAb (ATL-HPA061435) Datasheet (External Link)
Vendor Page Anti SHROOM2 pAb (ATL-HPA061435) at Atlas Antibodies

Documents & Links for Anti SHROOM2 pAb (ATL-HPA061435)
Datasheet Anti SHROOM2 pAb (ATL-HPA061435) Datasheet (External Link)
Vendor Page Anti SHROOM2 pAb (ATL-HPA061435)