Description
Product Description
Protein Description: shroom family member 2
Gene Name: SHROOM2
Alternative Gene Name: APXL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045180: 44%, ENSRNOG00000024322: 42%
Entrez Gene ID: 357
Uniprot ID: Q13796
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SHROOM2
Alternative Gene Name: APXL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045180: 44%, ENSRNOG00000024322: 42%
Entrez Gene ID: 357
Uniprot ID: Q13796
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SPRHHLPQPEGPPDARETGRCYPLDKGAEGCSAGAQEPPRASRAEKASQRLAASITWADGESSRICPQETPLLHSLTQ |
Gene Sequence | SPRHHLPQPEGPPDARETGRCYPLDKGAEGCSAGAQEPPRASRAEKASQRLAASITWADGESSRICPQETPLLHSLTQ |
Gene ID - Mouse | ENSMUSG00000045180 |
Gene ID - Rat | ENSRNOG00000024322 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SHROOM2 pAb (ATL-HPA061435) | |
Datasheet | Anti SHROOM2 pAb (ATL-HPA061435) Datasheet (External Link) |
Vendor Page | Anti SHROOM2 pAb (ATL-HPA061435) at Atlas Antibodies |
Documents & Links for Anti SHROOM2 pAb (ATL-HPA061435) | |
Datasheet | Anti SHROOM2 pAb (ATL-HPA061435) Datasheet (External Link) |
Vendor Page | Anti SHROOM2 pAb (ATL-HPA061435) |