Description
Product Description
Protein Description: shisa family member 7
Gene Name: SHISA7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053550: 97%, ENSRNOG00000016877: 97%
Entrez Gene ID: 729956
Uniprot ID: A6NL88
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SHISA7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053550: 97%, ENSRNOG00000016877: 97%
Entrez Gene ID: 729956
Uniprot ID: A6NL88
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VGAKVAFSKASRAPRAHRDINVPRALVDILRHQA |
Gene Sequence | VGAKVAFSKASRAPRAHRDINVPRALVDILRHQA |
Gene ID - Mouse | ENSMUSG00000053550 |
Gene ID - Rat | ENSRNOG00000016877 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SHISA7 pAb (ATL-HPA058935) | |
Datasheet | Anti SHISA7 pAb (ATL-HPA058935) Datasheet (External Link) |
Vendor Page | Anti SHISA7 pAb (ATL-HPA058935) at Atlas Antibodies |
Documents & Links for Anti SHISA7 pAb (ATL-HPA058935) | |
Datasheet | Anti SHISA7 pAb (ATL-HPA058935) Datasheet (External Link) |
Vendor Page | Anti SHISA7 pAb (ATL-HPA058935) |