Anti SHISA7 pAb (ATL-HPA058935)

Atlas Antibodies

Catalog No: ATL-HPA058935-25

• 

Product Description

Protein Description: shisa family member 7
Gene Name: SHISA7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053550: 97%, ENSRNOG00000016877: 97%
Entrez Gene ID: 729956
Uniprot ID: A6NL88
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGAKVAFSKASRAPRAHRDINVPRALVDILRHQA
• Gene Sequence: VGAKVAFSKASRAPRAHRDINVPRALVDILRHQA
• Gene ID - Mouse: ENSMUSG00000053550
• Gene ID - Rat: ENSRNOG00000016877
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.