Anti SHISA4 pAb (ATL-HPA067885)

Atlas Antibodies

Catalog No: ATL-HPA067885-25

• 

Product Description

Protein Description: shisa family member 4
Gene Name: SHISA4
Alternative Gene Name: C1orf40, hShisa4, TMEM58
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041889: 86%, ENSRNOG00000007369: 83%
Entrez Gene ID: 149345
Uniprot ID: Q96DD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RQQLQSPFEGQEIPMTGIPVQPVYPYPQDPQAGPA
• Gene Sequence: RQQLQSPFEGQEIPMTGIPVQPVYPYPQDPQAGPA
• Gene ID - Mouse: ENSMUSG00000041889
• Gene ID - Rat: ENSRNOG00000007369
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.