Protein Description: SHC (Src homology 2 domain containing) family, member 4
Gene Name: SHC4
Alternative Gene Name: RaLP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035109: 75%, ENSRNOG00000037134: 75%
Entrez Gene ID: 399694
Uniprot ID: Q6S5L8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SHC4
Alternative Gene Name: RaLP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035109: 75%, ENSRNOG00000037134: 75%
Entrez Gene ID: 399694
Uniprot ID: Q6S5L8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SQESPTPLCTLIPRMASMKLANPATLLSLKNFCLGTKEVPRLKLQESRDPGSSGPSS |
Documents & Links for Anti SHC4 pAb (ATL-HPA074146) | |
Datasheet | Anti SHC4 pAb (ATL-HPA074146) Datasheet (External Link) |
Vendor Page | Anti SHC4 pAb (ATL-HPA074146) at Atlas |
Documents & Links for Anti SHC4 pAb (ATL-HPA074146) | |
Datasheet | Anti SHC4 pAb (ATL-HPA074146) Datasheet (External Link) |
Vendor Page | Anti SHC4 pAb (ATL-HPA074146) |