Description
Product Description
Protein Description: SHC (Src homology 2 domain containing) transforming protein 3
Gene Name: SHC3
Alternative Gene Name: N-Shc, NSHC, SHCC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021448: 89%, ENSRNOG00000014366: 92%
Entrez Gene ID: 53358
Uniprot ID: Q92529
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SHC3
Alternative Gene Name: N-Shc, NSHC, SHCC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021448: 89%, ENSRNOG00000014366: 92%
Entrez Gene ID: 53358
Uniprot ID: Q92529
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LRFKQYLQCPTKIPALHDRMQSLDEPWTEEEGDGSD |
Gene Sequence | LRFKQYLQCPTKIPALHDRMQSLDEPWTEEEGDGSD |
Gene ID - Mouse | ENSMUSG00000021448 |
Gene ID - Rat | ENSRNOG00000014366 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SHC3 pAb (ATL-HPA072448) | |
Datasheet | Anti SHC3 pAb (ATL-HPA072448) Datasheet (External Link) |
Vendor Page | Anti SHC3 pAb (ATL-HPA072448) at Atlas Antibodies |
Documents & Links for Anti SHC3 pAb (ATL-HPA072448) | |
Datasheet | Anti SHC3 pAb (ATL-HPA072448) Datasheet (External Link) |
Vendor Page | Anti SHC3 pAb (ATL-HPA072448) |