Protein Description: SH3-domain GRB2-like 2
Gene Name: SH3GL2
Alternative Gene Name: CNSA2, EEN-B1, SH3D2A, SH3P4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028488: 100%, ENSRNOG00000006761: 100%
Entrez Gene ID: 6456
Uniprot ID: Q99962
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SH3GL2
Alternative Gene Name: CNSA2, EEN-B1, SH3D2A, SH3P4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028488: 100%, ENSRNOG00000006761: 100%
Entrez Gene ID: 6456
Uniprot ID: Q99962
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELS |
| Documents & Links for Anti SH3GL2 pAb (ATL-HPA063573 w/enhanced validation) | |
| Datasheet | Anti SH3GL2 pAb (ATL-HPA063573 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SH3GL2 pAb (ATL-HPA063573 w/enhanced validation) at Atlas |
| Documents & Links for Anti SH3GL2 pAb (ATL-HPA063573 w/enhanced validation) | |
| Datasheet | Anti SH3GL2 pAb (ATL-HPA063573 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SH3GL2 pAb (ATL-HPA063573 w/enhanced validation) |
| Citations for Anti SH3GL2 pAb (ATL-HPA063573 w/enhanced validation) – 1 Found |
| Bedri, Sahl Khalid; Nilsson, Ola B; Fink, Katharina; Månberg, Anna; Hamsten, Carl; Ayoglu, Burcu; Manouchehrinia, Ali; Nilsson, Peter; Olsson, Tomas; Hillert, Jan; Grönlund, Hans; Glaser, Anna. Plasma protein profiling reveals candidate biomarkers for multiple sclerosis treatment. Plos One. 14(5):e0217208. PubMed |