Anti SH3D21 pAb (ATL-HPA066168)

Catalog No:
ATL-HPA066168-25
$447.00

Description

Product Description

Protein Description: SH3 domain containing 21
Gene Name: SH3D21
Alternative Gene Name: C1orf113, FLJ22938
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029419: 27%, ENSRNOG00000009341: 29%
Entrez Gene ID: 79729
Uniprot ID: A4FU49
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IQFHHFSSEEALQKVKYFVAKEDPSSQEEAHTPEAPPPQPPSSERCLGEMKCTLVRGDSSPRQAELKSGPAS
Gene Sequence IQFHHFSSEEALQKVKYFVAKEDPSSQEEAHTPEAPPPQPPSSERCLGEMKCTLVRGDSSPRQAELKSGPAS
Gene ID - Mouse ENSMUSG00000029419
Gene ID - Rat ENSRNOG00000009341
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SH3D21 pAb (ATL-HPA066168)
Datasheet Anti SH3D21 pAb (ATL-HPA066168) Datasheet (External Link)
Vendor Page Anti SH3D21 pAb (ATL-HPA066168) at Atlas Antibodies

Documents & Links for Anti SH3D21 pAb (ATL-HPA066168)
Datasheet Anti SH3D21 pAb (ATL-HPA066168) Datasheet (External Link)
Vendor Page Anti SH3D21 pAb (ATL-HPA066168)

Product Description

Protein Description: SH3 domain containing 21
Gene Name: SH3D21
Alternative Gene Name: C1orf113, FLJ22938
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029419: 27%, ENSRNOG00000009341: 29%
Entrez Gene ID: 79729
Uniprot ID: A4FU49
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IQFHHFSSEEALQKVKYFVAKEDPSSQEEAHTPEAPPPQPPSSERCLGEMKCTLVRGDSSPRQAELKSGPAS
Gene Sequence IQFHHFSSEEALQKVKYFVAKEDPSSQEEAHTPEAPPPQPPSSERCLGEMKCTLVRGDSSPRQAELKSGPAS
Gene ID - Mouse ENSMUSG00000029419
Gene ID - Rat ENSRNOG00000009341
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SH3D21 pAb (ATL-HPA066168)
Datasheet Anti SH3D21 pAb (ATL-HPA066168) Datasheet (External Link)
Vendor Page Anti SH3D21 pAb (ATL-HPA066168) at Atlas Antibodies

Documents & Links for Anti SH3D21 pAb (ATL-HPA066168)
Datasheet Anti SH3D21 pAb (ATL-HPA066168) Datasheet (External Link)
Vendor Page Anti SH3D21 pAb (ATL-HPA066168)