Anti SH3BP5 pAb (ATL-HPA057988)

Atlas Antibodies

Catalog No: ATL-HPA057988-25

• 
• 

Product Description

Protein Description: SH3-domain binding protein 5 (BTK-associated)
Gene Name: SH3BP5
Alternative Gene Name: Sab
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021892: 89%, ENSRNOG00000052391: 89%
Entrez Gene ID: 9467
Uniprot ID: O60239
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELKAKYYVQLEQLKKTVDDLQAKLTLAKGEYKMALKNLEMISDEIHERRRSSAMGPRGCGVGAEGSSTSVEDLPGSKPEPDAISVASEAFEDDSCSNFVSE
• Gene Sequence: ELKAKYYVQLEQLKKTVDDLQAKLTLAKGEYKMALKNLEMISDEIHERRRSSAMGPRGCGVGAEGSSTSVEDLPGSKPEPDAISVASEAFEDDSCSNFVSE
• Gene ID - Mouse: ENSMUSG00000021892
• Gene ID - Rat: ENSRNOG00000052391
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti SH3BP5 pAb (ATL-HPA057988) – 1 Found

Jenkins, Meredith L; Margaria, Jean Piero; Stariha, Jordan T B; Hoffmann, Reece M; McPhail, Jacob A; Hamelin, David J; Boulanger, Martin J; Hirsch, Emilio; Burke, John E. Structural determinants of Rab11 activation by the guanine nucleotide exchange factor SH3BP5. Nature Communications. 2018;9(1):3772.