Protein Description: SH2 domain containing 7
Gene Name: SH2D7
Alternative Gene Name: LOC646892
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038250: 27%, ENSRNOG00000023870: 59%
Entrez Gene ID: 646892
Uniprot ID: A6NKC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SH2D7
Alternative Gene Name: LOC646892
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038250: 27%, ENSRNOG00000023870: 59%
Entrez Gene ID: 646892
Uniprot ID: A6NKC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | HHYQEAQLEPFKEMLTAACPRPEDNDLYDAITRGLHQTIVDPENPPATAFLTVVPDKAASPRSSPKPQVSFLHAQKSLDVSPR |
Documents & Links for Anti SH2D7 pAb (ATL-HPA076728 w/enhanced validation) | |
Datasheet | Anti SH2D7 pAb (ATL-HPA076728 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SH2D7 pAb (ATL-HPA076728 w/enhanced validation) at Atlas |
Documents & Links for Anti SH2D7 pAb (ATL-HPA076728 w/enhanced validation) | |
Datasheet | Anti SH2D7 pAb (ATL-HPA076728 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SH2D7 pAb (ATL-HPA076728 w/enhanced validation) |