Anti SH2D7 pAb (ATL-HPA058382)

Catalog No:
ATL-HPA058382-25
$447.00

Description

Product Description

Protein Description: SH2 domain containing 7
Gene Name: SH2D7
Alternative Gene Name: LOC646892
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038250: 27%, ENSRNOG00000023870: 59%
Entrez Gene ID: 646892
Uniprot ID: A6NKC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HHYQEAQLEPFKEMLTAACPRPEDNDLYDAITRGLHQTIVDPENPPATAFLTVVPDKAASPRSSPKPQVSFLHAQKSLDVSPR
Gene Sequence HHYQEAQLEPFKEMLTAACPRPEDNDLYDAITRGLHQTIVDPENPPATAFLTVVPDKAASPRSSPKPQVSFLHAQKSLDVSPR
Gene ID - Mouse ENSMUSG00000038250
Gene ID - Rat ENSRNOG00000023870
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SH2D7 pAb (ATL-HPA058382)
Datasheet Anti SH2D7 pAb (ATL-HPA058382) Datasheet (External Link)
Vendor Page Anti SH2D7 pAb (ATL-HPA058382) at Atlas Antibodies

Documents & Links for Anti SH2D7 pAb (ATL-HPA058382)
Datasheet Anti SH2D7 pAb (ATL-HPA058382) Datasheet (External Link)
Vendor Page Anti SH2D7 pAb (ATL-HPA058382)

Product Description

Protein Description: SH2 domain containing 7
Gene Name: SH2D7
Alternative Gene Name: LOC646892
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038250: 27%, ENSRNOG00000023870: 59%
Entrez Gene ID: 646892
Uniprot ID: A6NKC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HHYQEAQLEPFKEMLTAACPRPEDNDLYDAITRGLHQTIVDPENPPATAFLTVVPDKAASPRSSPKPQVSFLHAQKSLDVSPR
Gene Sequence HHYQEAQLEPFKEMLTAACPRPEDNDLYDAITRGLHQTIVDPENPPATAFLTVVPDKAASPRSSPKPQVSFLHAQKSLDVSPR
Gene ID - Mouse ENSMUSG00000038250
Gene ID - Rat ENSRNOG00000023870
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SH2D7 pAb (ATL-HPA058382)
Datasheet Anti SH2D7 pAb (ATL-HPA058382) Datasheet (External Link)
Vendor Page Anti SH2D7 pAb (ATL-HPA058382) at Atlas Antibodies

Documents & Links for Anti SH2D7 pAb (ATL-HPA058382)
Datasheet Anti SH2D7 pAb (ATL-HPA058382) Datasheet (External Link)
Vendor Page Anti SH2D7 pAb (ATL-HPA058382)