Protein Description: SH2 domain containing 3A
Gene Name: SH2D3A
Alternative Gene Name: NSP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028121: 33%, ENSRNOG00000054560: 32%
Entrez Gene ID: 10045
Uniprot ID: Q9BRG2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SH2D3A
Alternative Gene Name: NSP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028121: 33%, ENSRNOG00000054560: 32%
Entrez Gene ID: 10045
Uniprot ID: Q9BRG2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | WRQLRRSHTEAALAFEQELKPLMRALDEGAGPCDPGEVALPHVAPMVRLLEGEEVAGPLDESCERLLRTLHGARHMVRDAPKFRKVAAQRLRGFRPN |
| Documents & Links for Anti SH2D3A pAb (ATL-HPA064382) | |
| Datasheet | Anti SH2D3A pAb (ATL-HPA064382) Datasheet (External Link) |
| Vendor Page | Anti SH2D3A pAb (ATL-HPA064382) at Atlas |
| Documents & Links for Anti SH2D3A pAb (ATL-HPA064382) | |
| Datasheet | Anti SH2D3A pAb (ATL-HPA064382) Datasheet (External Link) |
| Vendor Page | Anti SH2D3A pAb (ATL-HPA064382) |