Anti SH2D3A pAb (ATL-HPA064382)

Atlas Antibodies

Catalog No: ATL-HPA064382-25

• 
• 

Product Description

Protein Description: SH2 domain containing 3A
Gene Name: SH2D3A
Alternative Gene Name: NSP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028121: 33%, ENSRNOG00000054560: 32%
Entrez Gene ID: 10045
Uniprot ID: Q9BRG2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WRQLRRSHTEAALAFEQELKPLMRALDEGAGPCDPGEVALPHVAPMVRLLEGEEVAGPLDESCERLLRTLHGARHMVRDAPKFRKVAAQRLRGFRPN
• Gene Sequence: WRQLRRSHTEAALAFEQELKPLMRALDEGAGPCDPGEVALPHVAPMVRLLEGEEVAGPLDESCERLLRTLHGARHMVRDAPKFRKVAAQRLRGFRPN
• Gene ID - Mouse: ENSMUSG00000028121
• Gene ID - Rat: ENSRNOG00000054560
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.