Protein Description: SH2 domain containing 2A
Gene Name: SH2D2A
Alternative Gene Name: F2771, TSAd
Isotype: IgG
Interspecies mouse/rat: , ENSRNOG00000013294: 27%
Entrez Gene ID: 9047
Uniprot ID: Q9NP31
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SH2D2A
Alternative Gene Name: F2771, TSAd
Isotype: IgG
Interspecies mouse/rat: , ENSRNOG00000013294: 27%
Entrez Gene ID: 9047
Uniprot ID: Q9NP31
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PSNIYVEVEDEGLPATLGHPVLRKSWSRPVPGGQNTGGSQLHSENSVIGQGPPLPHQPPPAWRHTLPHNLSRQVLQDRGQAWLPLGPPQ |
Documents & Links for Anti SH2D2A pAb (ATL-HPA074482) | |
Datasheet | Anti SH2D2A pAb (ATL-HPA074482) Datasheet (External Link) |
Vendor Page | Anti SH2D2A pAb (ATL-HPA074482) at Atlas |
Documents & Links for Anti SH2D2A pAb (ATL-HPA074482) | |
Datasheet | Anti SH2D2A pAb (ATL-HPA074482) Datasheet (External Link) |
Vendor Page | Anti SH2D2A pAb (ATL-HPA074482) |