Anti SH2B1 pAb (ATL-HPA076175)

Atlas Antibodies

Catalog No: ATL-HPA076175-25

• 

Product Description

Protein Description: SH2B adaptor protein 1
Gene Name: SH2B1
Alternative Gene Name: FLJ30542, SH2B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030733: 93%, ENSRNOG00000049181: 91%
Entrez Gene ID: 25970
Uniprot ID: Q9NRF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLGGNSNSNSSGGAGTVGRGLVSDGTSPGERWTHRFERLRLSRGGGALKDGAGMVQREELLSFMGAEEAAPDPAGV
• Gene Sequence: VLGGNSNSNSSGGAGTVGRGLVSDGTSPGERWTHRFERLRLSRGGGALKDGAGMVQREELLSFMGAEEAAPDPAGV
• Gene ID - Mouse: ENSMUSG00000030733
• Gene ID - Rat: ENSRNOG00000049181
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.