Protein Description: shugoshin 1
Gene Name: SGO1
Alternative Gene Name: NY-BR-85, SGOL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023940: 42%, ENSRNOG00000020433: 22%
Entrez Gene ID: 151648
Uniprot ID: Q5FBB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SGO1
Alternative Gene Name: NY-BR-85, SGOL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023940: 42%, ENSRNOG00000020433: 22%
Entrez Gene ID: 151648
Uniprot ID: Q5FBB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETH |
Documents & Links for Anti SGO1 pAb (ATL-HPA069857 w/enhanced validation) | |
Datasheet | Anti SGO1 pAb (ATL-HPA069857 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SGO1 pAb (ATL-HPA069857 w/enhanced validation) at Atlas |
Documents & Links for Anti SGO1 pAb (ATL-HPA069857 w/enhanced validation) | |
Datasheet | Anti SGO1 pAb (ATL-HPA069857 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SGO1 pAb (ATL-HPA069857 w/enhanced validation) |