Protein Description: sarcoglycan, epsilon
Gene Name: SGCE
Alternative Gene Name: DYT11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004631: 94%, ENSRNOG00000046905: 96%
Entrez Gene ID: 8910
Uniprot ID: O43556
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SGCE
Alternative Gene Name: DYT11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004631: 94%, ENSRNOG00000046905: 96%
Entrez Gene ID: 8910
Uniprot ID: O43556
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DIQLVHHSAIQKSTKELRDMSKNREIAWPLSTLPVFHPVTGEIIPPLHTDNYDSTNMPLMQTQQNLPHQTQIPQQQTTGKWY |
| Documents & Links for Anti SGCE pAb (ATL-HPA074790) | |
| Datasheet | Anti SGCE pAb (ATL-HPA074790) Datasheet (External Link) |
| Vendor Page | Anti SGCE pAb (ATL-HPA074790) at Atlas |
| Documents & Links for Anti SGCE pAb (ATL-HPA074790) | |
| Datasheet | Anti SGCE pAb (ATL-HPA074790) Datasheet (External Link) |
| Vendor Page | Anti SGCE pAb (ATL-HPA074790) |