Protein Description: sideroflexin 1
Gene Name: SFXN1
Alternative Gene Name: FLJ12876
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021474: 84%, ENSRNOG00000018279: 91%
Entrez Gene ID: 94081
Uniprot ID: Q9H9B4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SFXN1
Alternative Gene Name: FLJ12876
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021474: 84%, ENSRNOG00000018279: 91%
Entrez Gene ID: 94081
Uniprot ID: Q9H9B4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SSMSVTSLEAELQAKIQESHPELRRVYFNKGL |
| Documents & Links for Anti SFXN1 pAb (ATL-HPA063745 w/enhanced validation) | |
| Datasheet | Anti SFXN1 pAb (ATL-HPA063745 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SFXN1 pAb (ATL-HPA063745 w/enhanced validation) at Atlas |
| Documents & Links for Anti SFXN1 pAb (ATL-HPA063745 w/enhanced validation) | |
| Datasheet | Anti SFXN1 pAb (ATL-HPA063745 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SFXN1 pAb (ATL-HPA063745 w/enhanced validation) |
| Citations for Anti SFXN1 pAb (ATL-HPA063745 w/enhanced validation) – 1 Found |
| Tifoun, Nesrine; Bekhouche, Mourad; De Las Heras, José M; Guillaume, Arnaud; Bouleau, Sylvina; Guénal, Isabelle; Mignotte, Bernard; Le Floch, Nathalie. A High-Throughput Search for SFXN1 Physical Partners Led to the Identification of ATAD3, HSD10 and TIM50. Biology. 2022;11(9) PubMed |