Anti SFTPB pAb (ATL-HPA062148 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA062148-25

• 

Product Description

Protein Description: surfactant protein B
Gene Name: SFTPB
Alternative Gene Name: SFTP3, SP-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000103879: 65%, ENSRNOG00000010761: 61%
Entrez Gene ID: 6439
Uniprot ID: P07988
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLVIDYFQNQIDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLS
• Gene Sequence: PLVIDYFQNQIDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLS
• Gene ID - Mouse: ENSMUSG00000103879
• Gene ID - Rat: ENSRNOG00000010761
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.