Anti SFMBT2 pAb (ATL-HPA070388)

Atlas Antibodies

Catalog No: ATL-HPA070388-25

• 

Product Description

Protein Description: Scm like with four mbt domains 2
Gene Name: SFMBT2
Alternative Gene Name: KIAA1617
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061186: 56%, ENSRNOG00000016645: 45%
Entrez Gene ID: 57713
Uniprot ID: Q5VUG0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PERTRRGRGAPAASSAEEGEKCPPTKPEGTEDTKQEEEERLVLESNPLEWTVTDVVRFIKLTDC
• Gene Sequence: PERTRRGRGAPAASSAEEGEKCPPTKPEGTEDTKQEEEERLVLESNPLEWTVTDVVRFIKLTDC
• Gene ID - Mouse: ENSMUSG00000061186
• Gene ID - Rat: ENSRNOG00000016645
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.