Protein Description: Scm like with four mbt domains 2
Gene Name: SFMBT2
Alternative Gene Name: KIAA1617
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061186: 56%, ENSRNOG00000016645: 45%
Entrez Gene ID: 57713
Uniprot ID: Q5VUG0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SFMBT2
Alternative Gene Name: KIAA1617
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061186: 56%, ENSRNOG00000016645: 45%
Entrez Gene ID: 57713
Uniprot ID: Q5VUG0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PERTRRGRGAPAASSAEEGEKCPPTKPEGTEDTKQEEEERLVLESNPLEWTVTDVVRFIKLTDC |
Documents & Links for Anti SFMBT2 pAb (ATL-HPA070388) | |
Datasheet | Anti SFMBT2 pAb (ATL-HPA070388) Datasheet (External Link) |
Vendor Page | Anti SFMBT2 pAb (ATL-HPA070388) at Atlas |
Documents & Links for Anti SFMBT2 pAb (ATL-HPA070388) | |
Datasheet | Anti SFMBT2 pAb (ATL-HPA070388) Datasheet (External Link) |
Vendor Page | Anti SFMBT2 pAb (ATL-HPA070388) |