Description
Product Description
Protein Description: splicing factor 3b, subunit 4, 49kDa
Gene Name: SF3B4
Alternative Gene Name: Hsh49, SAP49, SF3b49
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068856: 100%, ENSRNOG00000021181: 100%
Entrez Gene ID: 10262
Uniprot ID: Q15427
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SF3B4
Alternative Gene Name: Hsh49, SAP49, SF3b49
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068856: 100%, ENSRNOG00000021181: 100%
Entrez Gene ID: 10262
Uniprot ID: Q15427
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNP |
Gene Sequence | VSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNP |
Gene ID - Mouse | ENSMUSG00000068856 |
Gene ID - Rat | ENSRNOG00000021181 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SF3B4 pAb (ATL-HPA064660) | |
Datasheet | Anti SF3B4 pAb (ATL-HPA064660) Datasheet (External Link) |
Vendor Page | Anti SF3B4 pAb (ATL-HPA064660) at Atlas Antibodies |
Documents & Links for Anti SF3B4 pAb (ATL-HPA064660) | |
Datasheet | Anti SF3B4 pAb (ATL-HPA064660) Datasheet (External Link) |
Vendor Page | Anti SF3B4 pAb (ATL-HPA064660) |