Anti SEZ6L2 pAb (ATL-HPA064471 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA064471-25

• 

Product Description

Protein Description: seizure related 6 homolog (mouse)-like 2
Gene Name: SEZ6L2
Alternative Gene Name: FLJ90517, PSK-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030683: 96%, ENSRNOG00000027098: 99%
Entrez Gene ID: 26470
Uniprot ID: Q6UXD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPEYRPGALATFSCLPGYALEPPGPPNAIECV
• Gene Sequence: RGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPEYRPGALATFSCLPGYALEPPGPPNAIECV
• Gene ID - Mouse: ENSMUSG00000030683
• Gene ID - Rat: ENSRNOG00000027098
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.