Anti SETD1B pAb (ATL-HPA059412)

Atlas Antibodies

Catalog No: ATL-HPA059412-25

• 

Product Description

Protein Description: SET domain containing 1B
Gene Name: SETD1B
Alternative Gene Name: KIAA1076, KMT2G, Set1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038384: 97%, ENSRNOG00000001337: 97%
Entrez Gene ID: 23067
Uniprot ID: Q9UPS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLQFVNLPPYRGPFSLSNSGPGRGQHWPPLPKFDPSVPPPGYMPRQEDPHKATVDGVLLVVLKELKAIMK
• Gene Sequence: GLQFVNLPPYRGPFSLSNSGPGRGQHWPPLPKFDPSVPPPGYMPRQEDPHKATVDGVLLVVLKELKAIMK
• Gene ID - Mouse: ENSMUSG00000038384
• Gene ID - Rat: ENSRNOG00000001337
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.