Description
Product Description
Protein Description: SET nuclear proto-oncogene
Gene Name: SET
Alternative Gene Name: 2PP2A, IPP2A2, PHAPII
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054766: 77%, ENSRNOG00000025892: 77%
Entrez Gene ID: 6418
Uniprot ID: Q01105
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SET
Alternative Gene Name: 2PP2A, IPP2A2, PHAPII
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054766: 77%, ENSRNOG00000025892: 77%
Entrez Gene ID: 6418
Uniprot ID: Q01105
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEID |
Gene Sequence | MAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEID |
Gene ID - Mouse | ENSMUSG00000054766 |
Gene ID - Rat | ENSRNOG00000025892 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SET pAb (ATL-HPA063683) | |
Datasheet | Anti SET pAb (ATL-HPA063683) Datasheet (External Link) |
Vendor Page | Anti SET pAb (ATL-HPA063683) at Atlas Antibodies |
Documents & Links for Anti SET pAb (ATL-HPA063683) | |
Datasheet | Anti SET pAb (ATL-HPA063683) Datasheet (External Link) |
Vendor Page | Anti SET pAb (ATL-HPA063683) |