![Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human Liver tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/99176/178627/atl-hpa063683_anti-set-pab-atl-hpa063683_60289__50933.1681134147.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human Liver tissue")
Protein Description: SET nuclear proto-oncogene
Gene Name: SET
Alternative Gene Name: 2PP2A, IPP2A2, PHAPII
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054766: 77%, ENSRNOG00000025892: 77%
Entrez Gene ID: 6418
Uniprot ID: Q01105
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SET
Alternative Gene Name: 2PP2A, IPP2A2, PHAPII
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054766: 77%, ENSRNOG00000025892: 77%
Entrez Gene ID: 6418
Uniprot ID: Q01105
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEID |
| Documents & Links for Anti SET pAb (ATL-HPA063683) | |
| Datasheet | Anti SET pAb (ATL-HPA063683) Datasheet (External Link) |
| Vendor Page | Anti SET pAb (ATL-HPA063683) at Atlas |
| Documents & Links for Anti SET pAb (ATL-HPA063683) | |
| Datasheet | Anti SET pAb (ATL-HPA063683) Datasheet (External Link) |
| Vendor Page | Anti SET pAb (ATL-HPA063683) |