Anti SESTD1 pAb (ATL-HPA077408)

Catalog No:
ATL-HPA077408-25
$447.00

Description

Product Description

Protein Description: SEC14 and spectrin domain containing 1
Gene Name: SESTD1
Alternative Gene Name: DKFZp434O0515, Solo
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042272: 99%, ENSRNOG00000012603: 99%
Entrez Gene ID: 91404
Uniprot ID: Q86VW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WNVVKTVVVMLQNVVPAEVSLVCVVKPDEFWDKKVTHFCFWKEKDRLGFEVILVSANKLTRYIEPCQLTEDFGGSL
Gene Sequence WNVVKTVVVMLQNVVPAEVSLVCVVKPDEFWDKKVTHFCFWKEKDRLGFEVILVSANKLTRYIEPCQLTEDFGGSL
Gene ID - Mouse ENSMUSG00000042272
Gene ID - Rat ENSRNOG00000012603
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SESTD1 pAb (ATL-HPA077408)
Datasheet Anti SESTD1 pAb (ATL-HPA077408) Datasheet (External Link)
Vendor Page Anti SESTD1 pAb (ATL-HPA077408) at Atlas Antibodies

Documents & Links for Anti SESTD1 pAb (ATL-HPA077408)
Datasheet Anti SESTD1 pAb (ATL-HPA077408) Datasheet (External Link)
Vendor Page Anti SESTD1 pAb (ATL-HPA077408)

Product Description

Protein Description: SEC14 and spectrin domain containing 1
Gene Name: SESTD1
Alternative Gene Name: DKFZp434O0515, Solo
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042272: 99%, ENSRNOG00000012603: 99%
Entrez Gene ID: 91404
Uniprot ID: Q86VW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WNVVKTVVVMLQNVVPAEVSLVCVVKPDEFWDKKVTHFCFWKEKDRLGFEVILVSANKLTRYIEPCQLTEDFGGSL
Gene Sequence WNVVKTVVVMLQNVVPAEVSLVCVVKPDEFWDKKVTHFCFWKEKDRLGFEVILVSANKLTRYIEPCQLTEDFGGSL
Gene ID - Mouse ENSMUSG00000042272
Gene ID - Rat ENSRNOG00000012603
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SESTD1 pAb (ATL-HPA077408)
Datasheet Anti SESTD1 pAb (ATL-HPA077408) Datasheet (External Link)
Vendor Page Anti SESTD1 pAb (ATL-HPA077408) at Atlas Antibodies

Documents & Links for Anti SESTD1 pAb (ATL-HPA077408)
Datasheet Anti SESTD1 pAb (ATL-HPA077408) Datasheet (External Link)
Vendor Page Anti SESTD1 pAb (ATL-HPA077408)