Anti SERTAD3 pAb (ATL-HPA068262)

Atlas Antibodies

Catalog No: ATL-HPA068262-25

• 

Product Description

Protein Description: SERTA domain containing 3
Gene Name: SERTAD3
Alternative Gene Name: RBT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055200: 79%, ENSRNOG00000037690: 76%
Entrez Gene ID: 29946
Uniprot ID: Q9UJW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ATIGSILRELDTSMDGTEPPQNPVTPLGLQNEVPPQPDPVFLEALSSRYLGDSGLDDFFLDIDTSAV
• Gene Sequence: ATIGSILRELDTSMDGTEPPQNPVTPLGLQNEVPPQPDPVFLEALSSRYLGDSGLDDFFLDIDTSAV
• Gene ID - Mouse: ENSMUSG00000055200
• Gene ID - Rat: ENSRNOG00000037690
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.