Description
Product Description
Protein Description: SERTA domain containing 3
Gene Name: SERTAD3
Alternative Gene Name: RBT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055200: 79%, ENSRNOG00000037690: 76%
Entrez Gene ID: 29946
Uniprot ID: Q9UJW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SERTAD3
Alternative Gene Name: RBT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055200: 79%, ENSRNOG00000037690: 76%
Entrez Gene ID: 29946
Uniprot ID: Q9UJW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ATIGSILRELDTSMDGTEPPQNPVTPLGLQNEVPPQPDPVFLEALSSRYLGDSGLDDFFLDIDTSAV |
Gene Sequence | ATIGSILRELDTSMDGTEPPQNPVTPLGLQNEVPPQPDPVFLEALSSRYLGDSGLDDFFLDIDTSAV |
Gene ID - Mouse | ENSMUSG00000055200 |
Gene ID - Rat | ENSRNOG00000037690 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SERTAD3 pAb (ATL-HPA068262) | |
Datasheet | Anti SERTAD3 pAb (ATL-HPA068262) Datasheet (External Link) |
Vendor Page | Anti SERTAD3 pAb (ATL-HPA068262) at Atlas Antibodies |
Documents & Links for Anti SERTAD3 pAb (ATL-HPA068262) | |
Datasheet | Anti SERTAD3 pAb (ATL-HPA068262) Datasheet (External Link) |
Vendor Page | Anti SERTAD3 pAb (ATL-HPA068262) |