Protein Description: SERTA domain containing 1
Gene Name: SERTAD1
Alternative Gene Name: SEI1, TRIP-Br1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008384: 91%, ENSRNOG00000024363: 89%
Entrez Gene ID: 29950
Uniprot ID: Q9UHV2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SERTAD1
Alternative Gene Name: SEI1, TRIP-Br1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008384: 91%, ENSRNOG00000024363: 89%
Entrez Gene ID: 29950
Uniprot ID: Q9UHV2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TSMYDNELWAPASEGLKPGPEDGPGKEEAPELDEAELDYLMDVLVGTQALERP |
| Documents & Links for Anti SERTAD1 pAb (ATL-HPA063323) | |
| Datasheet | Anti SERTAD1 pAb (ATL-HPA063323) Datasheet (External Link) |
| Vendor Page | Anti SERTAD1 pAb (ATL-HPA063323) at Atlas |
| Documents & Links for Anti SERTAD1 pAb (ATL-HPA063323) | |
| Datasheet | Anti SERTAD1 pAb (ATL-HPA063323) Datasheet (External Link) |
| Vendor Page | Anti SERTAD1 pAb (ATL-HPA063323) |