Description
Product Description
Protein Description: serpin peptidase inhibitor, clade B (ovalbumin), member 3
Gene Name: SERPINB3
Alternative Gene Name: HsT1196, SCC, SCCA1, T4-A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044594: 58%, ENSRNOG00000002578: 54%
Entrez Gene ID: 6317
Uniprot ID: P29508
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SERPINB3
Alternative Gene Name: HsT1196, SCC, SCCA1, T4-A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044594: 58%, ENSRNOG00000002578: 54%
Entrez Gene ID: 6317
Uniprot ID: P29508
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KVLHFDQVTENTTEKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELK |
| Gene Sequence | KVLHFDQVTENTTEKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELK |
| Gene ID - Mouse | ENSMUSG00000044594 |
| Gene ID - Rat | ENSRNOG00000002578 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti SERPINB3 pAb (ATL-HPA055992) | |
| Datasheet | Anti SERPINB3 pAb (ATL-HPA055992) Datasheet (External Link) |
| Vendor Page | Anti SERPINB3 pAb (ATL-HPA055992) at Atlas Antibodies |
| Documents & Links for Anti SERPINB3 pAb (ATL-HPA055992) | |
| Datasheet | Anti SERPINB3 pAb (ATL-HPA055992) Datasheet (External Link) |
| Vendor Page | Anti SERPINB3 pAb (ATL-HPA055992) |