Anti SERPINA5 pAb (ATL-HPA078846 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA078846-25

• 

Product Description

Protein Description: serpin family A member 5
Gene Name: SERPINA5
Alternative Gene Name: PAI3, PCI, PLANH3, PROCI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041550: 56%, ENSRNOG00000009855: 53%
Entrez Gene ID: 5104
Uniprot ID: P05154
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNAT
• Gene Sequence: KWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNAT
• Gene ID - Mouse: ENSMUSG00000041550
• Gene ID - Rat: ENSRNOG00000009855
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.