Protein Description: secretion regulating guanine nucleotide exchange factor
Gene Name: SERGEF
Alternative Gene Name: DelGEF, Gnefr
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030839: 83%, ENSRNOG00000011488: 80%
Entrez Gene ID: 26297
Uniprot ID: Q9UGK8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SERGEF
Alternative Gene Name: DelGEF, Gnefr
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030839: 83%, ENSRNOG00000011488: 80%
Entrez Gene ID: 26297
Uniprot ID: Q9UGK8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SLFGCPIQQVACGWDFTIMLTENGQVLSCGSNSFGQLGVPHGPRRCVVPQAIELHKEKVVCIAAGLRHAVAATASGIVFQW |
Documents & Links for Anti SERGEF pAb (ATL-HPA074086) | |
Datasheet | Anti SERGEF pAb (ATL-HPA074086) Datasheet (External Link) |
Vendor Page | Anti SERGEF pAb (ATL-HPA074086) at Atlas |
Documents & Links for Anti SERGEF pAb (ATL-HPA074086) | |
Datasheet | Anti SERGEF pAb (ATL-HPA074086) Datasheet (External Link) |
Vendor Page | Anti SERGEF pAb (ATL-HPA074086) |