Protein Description: small EDRK-rich factor 1A (telomeric)
Gene Name: SERF1A
Alternative Gene Name: 4F5, FAM2A, H4F5, SERF1, SMAM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051768: 38%, ENSRNOG00000051204: 38%
Entrez Gene ID: 8293
Uniprot ID: O75920
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SERF1A
Alternative Gene Name: 4F5, FAM2A, H4F5, SERF1, SMAM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051768: 38%, ENSRNOG00000051204: 38%
Entrez Gene ID: 8293
Uniprot ID: O75920
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SSGGQKSESKMSAGPHLPLKAPRENPCFPLPAAGGSR |
Documents & Links for Anti SERF1A pAb (ATL-HPA075271) | |
Datasheet | Anti SERF1A pAb (ATL-HPA075271) Datasheet (External Link) |
Vendor Page | Anti SERF1A pAb (ATL-HPA075271) at Atlas |
Documents & Links for Anti SERF1A pAb (ATL-HPA075271) | |
Datasheet | Anti SERF1A pAb (ATL-HPA075271) Datasheet (External Link) |
Vendor Page | Anti SERF1A pAb (ATL-HPA075271) |