Anti SERBP1 pAb (ATL-HPA020559)

Atlas

Catalog No: ATL-HPA020559-25

• 
• 
• 

Protein Description: SERPINE1 mRNA binding protein 1
Gene Name: SERBP1
Alternative Gene Name: CGI-55, CHD3IP, DKFZP564M2423, HABP4L, PAI-RBP1, PAIRBP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036371: 97%, ENSRNOG00000005890: 99%
Entrez Gene ID: 26135
Uniprot ID: Q8NC51
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Gene Sequence: GHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQLRKESQKDRKNPLPPSVGVVDKKEETQPPVALKKEGIRRVGRRPDQQLQGEGKIIDRRPERRPPRERRFE

Citations for Anti SERBP1 pAb (ATL-HPA020559) – 2 Found

Castello-Cros, Remedios; Bonuccelli, Gloria; Molchansky, Alex; Capozza, Franco; Witkiewicz, Agnieszka K; Birbe, Ruth C; Howell, Anthony; Pestell, Richard G; Whitaker-Menezes, Diana; Sotgia, Federica; Lisanti, Michael P. Matrix remodeling stimulates stromal autophagy, "fueling" cancer cell mitochondrial metabolism and metastasis. Cell Cycle (Georgetown, Tex.). 2011;10(12):2021-34. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.