Anti SEPT1 pAb (ATL-HPA073635 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA073635-25

• 

Product Description

Protein Description: septin 1
Gene Name: SEPT1
Alternative Gene Name: DIFF6, PNUTL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000486: 94%, ENSRNOG00000017804: 88%
Entrez Gene ID: 1731
Uniprot ID: Q8WYJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PVIGKADALMPQETQALKQKIRDQLKEEEIHIY
• Gene Sequence: PVIGKADALMPQETQALKQKIRDQLKEEEIHIY
• Gene ID - Mouse: ENSMUSG00000000486
• Gene ID - Rat: ENSRNOG00000017804
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.