Protein Description: septin 1
Gene Name: SEPT1
Alternative Gene Name: DIFF6, PNUTL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000486: 94%, ENSRNOG00000017804: 88%
Entrez Gene ID: 1731
Uniprot ID: Q8WYJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SEPT1
Alternative Gene Name: DIFF6, PNUTL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000486: 94%, ENSRNOG00000017804: 88%
Entrez Gene ID: 1731
Uniprot ID: Q8WYJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PVIGKADALMPQETQALKQKIRDQLKEEEIHIY |
| Documents & Links for Anti SEPT1 pAb (ATL-HPA073635 w/enhanced validation) | |
| Datasheet | Anti SEPT1 pAb (ATL-HPA073635 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SEPT1 pAb (ATL-HPA073635 w/enhanced validation) at Atlas |
| Documents & Links for Anti SEPT1 pAb (ATL-HPA073635 w/enhanced validation) | |
| Datasheet | Anti SEPT1 pAb (ATL-HPA073635 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SEPT1 pAb (ATL-HPA073635 w/enhanced validation) |