Protein Description: SUMO1/sentrin specific peptidase 7
Gene Name: SENP7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052917: 41%, ENSRNOG00000001616: 37%
Entrez Gene ID: 57337
Uniprot ID: Q9BQF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SENP7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052917: 41%, ENSRNOG00000001616: 37%
Entrez Gene ID: 57337
Uniprot ID: Q9BQF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SERGSQRSKTVDDNSAKQTAHNKEKRRKDDGISLLISDTQPEDLNSGSRGCDHLEQESRNKDVKYSDSKVELTLISRKTKRRLRNNLPDSQYCTSLD |
| Documents & Links for Anti SENP7 pAb (ATL-HPA071998) | |
| Datasheet | Anti SENP7 pAb (ATL-HPA071998) Datasheet (External Link) |
| Vendor Page | Anti SENP7 pAb (ATL-HPA071998) at Atlas |
| Documents & Links for Anti SENP7 pAb (ATL-HPA071998) | |
| Datasheet | Anti SENP7 pAb (ATL-HPA071998) Datasheet (External Link) |
| Vendor Page | Anti SENP7 pAb (ATL-HPA071998) |