Description
Product Description
Protein Description: sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6B
Gene Name: SEMA6B
Alternative Gene Name: SEM-SEMA-Y, SEMA-VIB, SEMAN, semaZ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001227: 89%, ENSRNOG00000045998: 87%
Entrez Gene ID: 10501
Uniprot ID: Q9H3T3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SEMA6B
Alternative Gene Name: SEM-SEMA-Y, SEMA-VIB, SEMAN, semaZ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001227: 89%, ENSRNOG00000045998: 87%
Entrez Gene ID: 10501
Uniprot ID: Q9H3T3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AGTVLKFLVRPNASTSGTSGLSVFLEEFETYRPDRCGRPGGGETGQRLLSLELDAASGGLLAAFPRCVVRVPVARCQQYSGCMKNCIG |
Gene Sequence | AGTVLKFLVRPNASTSGTSGLSVFLEEFETYRPDRCGRPGGGETGQRLLSLELDAASGGLLAAFPRCVVRVPVARCQQYSGCMKNCIG |
Gene ID - Mouse | ENSMUSG00000001227 |
Gene ID - Rat | ENSRNOG00000045998 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SEMA6B pAb (ATL-HPA055778 w/enhanced validation) | |
Datasheet | Anti SEMA6B pAb (ATL-HPA055778 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SEMA6B pAb (ATL-HPA055778 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SEMA6B pAb (ATL-HPA055778 w/enhanced validation) | |
Datasheet | Anti SEMA6B pAb (ATL-HPA055778 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SEMA6B pAb (ATL-HPA055778 w/enhanced validation) |