Protein Description: ssemaphorin 4F
Gene Name: SEMA4F
Alternative Gene Name: SEMAM, SEMAW
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000627: 86%, ENSRNOG00000006784: 87%
Entrez Gene ID: 10505
Uniprot ID: O95754
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SEMA4F
Alternative Gene Name: SEMAM, SEMAW
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000627: 86%, ENSRNOG00000006784: 87%
Entrez Gene ID: 10505
Uniprot ID: O95754
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DVAVLRPELGAGTPIFYGIFSSQWEGATISAVCAFRPQDIRTVLNGPFRELKHDCNRGLPVVDNDVPQPR |
| Documents & Links for Anti SEMA4F pAb (ATL-HPA064095) | |
| Datasheet | Anti SEMA4F pAb (ATL-HPA064095) Datasheet (External Link) |
| Vendor Page | Anti SEMA4F pAb (ATL-HPA064095) at Atlas |
| Documents & Links for Anti SEMA4F pAb (ATL-HPA064095) | |
| Datasheet | Anti SEMA4F pAb (ATL-HPA064095) Datasheet (External Link) |
| Vendor Page | Anti SEMA4F pAb (ATL-HPA064095) |