Protein Description: sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A
Gene Name: SEMA4A
Alternative Gene Name: CORD10, FLJ12287, SEMAB, SemB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028064: 89%, ENSRNOG00000019737: 91%
Entrez Gene ID: 64218
Uniprot ID: Q9H3S1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SEMA4A
Alternative Gene Name: CORD10, FLJ12287, SEMAB, SemB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028064: 89%, ENSRNOG00000019737: 91%
Entrez Gene ID: 64218
Uniprot ID: Q9H3S1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LPFNVIRHAVLLPADSPTAPHIYAVFTSQWQVGGTRSSAVCAFSLLDIERVFKGKYKELNKETSRWTTYRGPETNPRPGSCSVGPSSD |
Documents & Links for Anti SEMA4A pAb (ATL-HPA066006) | |
Datasheet | Anti SEMA4A pAb (ATL-HPA066006) Datasheet (External Link) |
Vendor Page | Anti SEMA4A pAb (ATL-HPA066006) at Atlas |
Documents & Links for Anti SEMA4A pAb (ATL-HPA066006) | |
Datasheet | Anti SEMA4A pAb (ATL-HPA066006) Datasheet (External Link) |
Vendor Page | Anti SEMA4A pAb (ATL-HPA066006) |