Protein Description: sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3E
Gene Name: SEMA3E
Alternative Gene Name: coll-5, KIAA0331, M-SemaK, SEMAH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063531: 93%, ENSRNOG00000006631: 92%
Entrez Gene ID: 9723
Uniprot ID: O15041
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SEMA3E
Alternative Gene Name: coll-5, KIAA0331, M-SemaK, SEMAH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063531: 93%, ENSRNOG00000006631: 92%
Entrez Gene ID: 9723
Uniprot ID: O15041
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RHGNAAQQCFGQQFVGDALDKTEEHLAYGIENNSTLLECTPRSLQAKVIWFVQKGRETRKEEVKTDDRVVK |
| Documents & Links for Anti SEMA3E pAb (ATL-HPA063804) | |
| Datasheet | Anti SEMA3E pAb (ATL-HPA063804) Datasheet (External Link) |
| Vendor Page | Anti SEMA3E pAb (ATL-HPA063804) at Atlas |
| Documents & Links for Anti SEMA3E pAb (ATL-HPA063804) | |
| Datasheet | Anti SEMA3E pAb (ATL-HPA063804) Datasheet (External Link) |
| Vendor Page | Anti SEMA3E pAb (ATL-HPA063804) |