Anti SELPLG pAb (ATL-HPA069062 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA069062-25

• 

Product Description

Protein Description: selectin P ligand
Gene Name: SELPLG
Alternative Gene Name: CD162, PSGL-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048163: 74%, ENSRNOG00000000699: 69%
Entrez Gene ID: 6404
Uniprot ID: Q14242
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSRKGHMYPVRNYSPTEMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSFLP
• Gene Sequence: LSRKGHMYPVRNYSPTEMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSFLP
• Gene ID - Mouse: ENSMUSG00000048163
• Gene ID - Rat: ENSRNOG00000000699
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.