Description
Product Description
Protein Description: selectin P ligand
Gene Name: SELPLG
Alternative Gene Name: CD162, PSGL-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048163: 74%, ENSRNOG00000000699: 69%
Entrez Gene ID: 6404
Uniprot ID: Q14242
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SELPLG
Alternative Gene Name: CD162, PSGL-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048163: 74%, ENSRNOG00000000699: 69%
Entrez Gene ID: 6404
Uniprot ID: Q14242
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LSRKGHMYPVRNYSPTEMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSFLP |
Gene Sequence | LSRKGHMYPVRNYSPTEMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSFLP |
Gene ID - Mouse | ENSMUSG00000048163 |
Gene ID - Rat | ENSRNOG00000000699 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SELPLG pAb (ATL-HPA069062 w/enhanced validation) | |
Datasheet | Anti SELPLG pAb (ATL-HPA069062 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SELPLG pAb (ATL-HPA069062 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SELPLG pAb (ATL-HPA069062 w/enhanced validation) | |
Datasheet | Anti SELPLG pAb (ATL-HPA069062 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SELPLG pAb (ATL-HPA069062 w/enhanced validation) |