Anti SELENOO pAb (ATL-HPA079100)

Catalog No:
ATL-HPA079100-25
$447.00

Description

Product Description

Protein Description: selenoprotein O
Gene Name: SELENOO
Alternative Gene Name: SELO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035757: 81%, ENSRNOG00000060120: 82%
Entrez Gene ID: 83642
Uniprot ID: Q9BVL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DPDHVCNASDNTGRYAYSKQPEVCRWNLRKLAEALQPELPLELGEAILAEEFDAEFQRHYLQKMRRKLGLVQVELEEDGALVSKLLETM
Gene Sequence DPDHVCNASDNTGRYAYSKQPEVCRWNLRKLAEALQPELPLELGEAILAEEFDAEFQRHYLQKMRRKLGLVQVELEEDGALVSKLLETM
Gene ID - Mouse ENSMUSG00000035757
Gene ID - Rat ENSRNOG00000060120
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SELENOO pAb (ATL-HPA079100)
Datasheet Anti SELENOO pAb (ATL-HPA079100) Datasheet (External Link)
Vendor Page Anti SELENOO pAb (ATL-HPA079100) at Atlas Antibodies

Documents & Links for Anti SELENOO pAb (ATL-HPA079100)
Datasheet Anti SELENOO pAb (ATL-HPA079100) Datasheet (External Link)
Vendor Page Anti SELENOO pAb (ATL-HPA079100)

Product Description

Protein Description: selenoprotein O
Gene Name: SELENOO
Alternative Gene Name: SELO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035757: 81%, ENSRNOG00000060120: 82%
Entrez Gene ID: 83642
Uniprot ID: Q9BVL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DPDHVCNASDNTGRYAYSKQPEVCRWNLRKLAEALQPELPLELGEAILAEEFDAEFQRHYLQKMRRKLGLVQVELEEDGALVSKLLETM
Gene Sequence DPDHVCNASDNTGRYAYSKQPEVCRWNLRKLAEALQPELPLELGEAILAEEFDAEFQRHYLQKMRRKLGLVQVELEEDGALVSKLLETM
Gene ID - Mouse ENSMUSG00000035757
Gene ID - Rat ENSRNOG00000060120
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SELENOO pAb (ATL-HPA079100)
Datasheet Anti SELENOO pAb (ATL-HPA079100) Datasheet (External Link)
Vendor Page Anti SELENOO pAb (ATL-HPA079100) at Atlas Antibodies

Documents & Links for Anti SELENOO pAb (ATL-HPA079100)
Datasheet Anti SELENOO pAb (ATL-HPA079100) Datasheet (External Link)
Vendor Page Anti SELENOO pAb (ATL-HPA079100)